Query Sequence
>H281DRAFT_03879
MTPDVTSQRADDTVPRGAFGGSQRIQQLFARYKILALLIAVAAIWIFFSVLTHGAFVTPRNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAAILDVNRHWPIGVTLPVVMLLGVLVGVFNGWWSTYRRVPSFIVGLGGMLAYRGILLGVTGGSTIAPVSDGFVFVGQGYLPTLAGDTLAVVLFVLLAFLTLRQRRNRERYQLSVVPVWQDVAKVIGAGVILAGFVATLDRYGGIPVPVLLLLALLGIFTWIATQTVFGRRIYAVGSNLEATRLSGVNTNRVKLAIFALMGLMCAFAGIVNTARLAAGSPSAGSMGELDAIAACFIGGTSMRGGSGTVYGALIGALVMASLDNGMSMLDVDAYWQMIVKGSILVLAVWIDVVSGSNRR
Hit FamilyFIG01304462
Hit Family FunctionXylose ABC transporter, permease protein XylH


back to search