Query Sequence
>H281DRAFT_03815
LQIALLATVRLTISIGLVPMSTNPSISNDTPTVTELRVVPVAGRDSMLLNLSGAHGPYFTRNIVILRDSAGHVGVGEVPGGENIRKTIDDARSFVVGQSIGNLQAILNKVRTQFADRDAGGRGLQTFDLRTTIHAVTALEAALLDLLGQHLGVPVAALLGEGQQRDAVEMLGYLFYIGDRNKTDLPYASGADARDDWDRVRTEEALTPEAVVRLAEAAQARYGFNDFKLKGGVLPGDAEIEAVTALAERFPNARVTLDPNGAWSLAEAIRLCRDKHDVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNDWGLTWGSHSNNHFDISLAMFTHVAAAAPGKITAIDTHWIWQDGQRLTREPLQIVGGKVKVPQKPGLGVELDMDEIEKAHALYQQHGLGARDDGVAMQYLIPNWKFDNKRPCLVR
Hit FamilyFIG00066504
Hit Family FunctionGlucarate dehydratase (EC 4.2.1.40)


back to search