Query Sequence
>H281DRAFT_03264
MNAANEQAKLSVQQIGHYIGGVAVDPASGRFKEVFNPATGQVTGAVALASIEEVDAAVQSAKAAFAAWSETAPLKRARILFKFKELLNKHHDELAMLITREHGKVFTDAQGEVVRGIEVVEFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFPVMVPMWMFPVALACGNTFVLKPSERDPSASLRIAELLKEAGLPDGVFNVVNGDKVAVDALIEHPDVAALSFVGSTPIAEYIHTEASKRGKRVQALGGAKNHLVVMPDADLDQAVDALIGAAYGSAGERCMAISVAVAVGNVADKLIEKLVPRVKSLVIKNGENLDAEMGPLVTAEHKAKVAGYIASGEEEGATLIVDGRAHPVANEAGFFIGGTLFDNVGTQMKIYKEEIFGPVLAVVRVPDFASAVELINAHEFGNGVSLFTSDGGVARAFGRQIQVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGVRFYTRYKSIMQRWPDSIAKGAEFTMPVAK
Hit FamilyFIG00137372
Hit Family FunctionMethylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)


back to search