Query Sequence
>H281DRAFT_02540
MERFQTVSGPAAPLLRRDVDTDIIIRIERLTGLPKDQLGQYAFEVWRGPDFVLDREPFVGAPILIAGANFGCGSSREAAVWALQGLGLRVVIAPSFGEIFMSNCFQNGVLPVVLPEQQVANLAEQAQSGAAVTADLDTCVITAPDGTSFPFQVDPVRREMLIEGADEMSLTLRRQDLIRQWQADDARRRPWVYVGSRSAD
Hit FamilyFIG00000282
Hit Family Function3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)


back to search