Query Sequence
>H281DRAFT_02531
MSDSVANDTRRLLKPGLYGLNDIEAGDYYLTAGVTVTETHVVNFAGVSGDYYDIHVDDVAAQEAGFPGRIAHGLLGLSLADGLKTRCPVLLKGLATLGWNWSFRAPLMIGDRIHVDIEVIGKRPTKRPDRGIATLRLKVLNQRGEVVQEGETLMMMPTTLA
Hit FamilyNo hits found for this sequence


back to search