Query Sequence
>H281DRAFT_02070
MKLATLKDGTRDGQLIVVSRDLHTAAVADAIAPTLQRVLDDWTFYAPQLHDLYDALNQGRARNTFSFDASDCMAPLPRAFQWADGSSYVNHVELVRRARGAEMPPEFWTDPLMYQGGSDDFIGPEDDVVCASEAFGIDFEAEVAVITTDVPMGATPEQSLKSVRLITLVNDVSLRNLIPAELAKGFGFFQSKPASSFAPVAVTPDELGEHWREGRVHRPMIVHWNGKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGAIVGSGTVSNKDAKRGYCCIAEKRCLETIEHGAPQTEFMKYGDTVKIEMFDEAGKSIFGSIEQSIAPLD
Hit FamilyFIG00007658
Hit Family FunctionFumarylacetoacetate hydrolase family protein


back to search