Query Sequence
>H281DRAFT_01455
VAHDALSSHSSADPFTPAADSALWRKNFLLGAATASYQIEGAVDEDGRLPSIWDTFCATPGKVLAGDSGAVACDHYHRWESDVDMLVGLGLEGYRLSIAWPRVMDANGASNRKGLDFYKRLLTRLKEKGITTFVTLYHWDLPQHLEDRGGWLNRETAYRFADYADLMSRELAGTVDAWATLNEPWCSAYLGYGNGHHAPGLANGRFATQAMHHLLLAHGLALPVLRENDPSSQKGIVANIGRGTPNSDSVEDQRAAQLFEIQHNAWILDPLLKGAYPEALFELWPGTEPLILGGDMQIISAPLDFLGINYYFRTNVATDGAHGFTEVPLEGVERTQMGWEVYPDGLRDLLIGFSHEYSNLPPVYITENGMASDDTVIDGRVNDTQRISFLKRHLAAVDEAIKAGVDIRGYFLWSLMDNFEWAFGYERRFGIVHVDYVTQKRTTKRSAELVSQFIEERKERSQRA
Hit FamilyFIG00133816
Hit Family FunctionBeta-galactosidase (EC 3.2.1.23) / Beta-glucosidase/6-phospho-beta-glucosidase


back to search