Query Sequence
>H281DRAFT_01115
MKSSFAAGKLFADRQLNFLLIVNVLVVLVATWLSRGQFVDIDNLQSMGGQLPELGLLALGIMLSMVSGNGGIDLSGVGLANLSGMVAAMLVPRLVNGDDSPVLYTSLFCAIVLMMGLLGGLLNGVVIARLRLTPILCTLGTQLLFTGFAVVISNGASVHVDYVEPLSDIGNGTVLQVPIAFCIFLAAVIVLGWLLKRSPFGLRLYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAGLISATHTSSAKWDYGNSYLLIAILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLLGVSQFFGDCAWGFLLLLSLAFAGGERVRAIFGLGGGGGSTQPAKPPASGSAGATQRR
Hit FamilyFIG00012945
Hit Family FunctionRibose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)


back to search