Query Sequence
>H281DRAFT_00224
MKKLALCVALAVMATGAMAKEWKTVRIGVDASYPPFESKAASGQVVGFDVDLTKALCARMNVKCVWVEQDFDGIIPALKGKKFDAIVSSLTVTDKRREQIDFSDKLFDAPARMIAKAGSPLLPTAESLKGKRIGVEQGTTQEAYAKAYWEPKGVTVVPYQNQDQVYADLTSGRLDAALQDEIQADAGFLKTPRGKGFAWAGPEVKDPKTIGEGTAIGLRKEDADLRTMFNRALAQVHQDGTFTKLEKQYFDFDIYPGH
Hit FamilyFIG00084786
Hit Family FunctionHistidine ABC transporter, histidine-binding periplasmic protein precursor HisJ (TC 3.A.1.3.1)


back to search