Query Sequence
>Ga0059261_3185
MRMLATLLATSLFAAPALAGPDFAPAVDADYAAHLEKLFIDFHKNPELSFKETRTAAMMAKELRAVGGITVTEGVGGTGVVGVMKNGDGPVVLVRADMDGLPLKEDSGLPYMSSVTQTDIDGVVKPVMHACGHDVHITSMIGTARQLARMKDRWKGTVVFVVQPGEERIDGARRMLADGLYTRFPKPNYAVAFHVTAGIPTGKIGLEPGISSSSSDSVDITIHGIGTHGAAPHLGKDPIVMGAEIVMALQTLVSREIAPLKPGVVTVGSFHSGFKHNIISDKAELQLTVRSDDEDTRKKLLDGIKRIAANVGRMNGLPEDKLPQVKVGFESTPVTLNDPELTKRVRGAITSAFGDNIIHYEERAGMGAEDFAYFIQKDLGVPGAYFIVGGTPQAEIDAGKAGGKPVSGHHSPFFKIDPKPSVTLGTTAMTVAVLDLLKK
Hit FamilyFIG00016846
Hit Family FunctionN-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)


back to search