Query Sequence
>Ga0059261_2298
MKRFGIIGFGRFGQLAARHLRDHFSVVVTDTADVGEAAAAIGVKTGSLADAADCDVVMLAVPVQAMAATIAAIAPLVRPGALVLDVASVKMLPARWMLEALPESVDIVATHPLFGPQSARGGLEGQPLVVCAVRGERHHKVAEFGRSLGLSVSITTAEEHDREMAYVQALTHLIGRALVNIRIPDEELKTNSYQHLLELCGLIRDDSKELFFAIQNLNPYAEEITRQFIAEANGLLAESLKAGNRSAAD
Hit FamilyFIG00132770
Hit Family FunctionPrephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)


back to search