Query Sequence
>Ga0059261_1893
MGVVLTAPEPVWALGAPLLEGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVGFCLPAANGKFVAGLQTGLAIFDPADRSFTPLTDPEPALPGNRLNDGTVDPAGRLWFGTMDDGESEATGRIYRLGGDGRCVAETAAVSISNGPAVSPDGRTLYHVDTLGGVIHSAAIGDDGILGDSRVFATIPNSEGFPDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFPVGAITKVAFGGPDLRTVYATTASKHLDADGRAEEPHAGDLFAFRVSVPGMPGTEVSVGL
Hit FamilyFIG00137422
Hit Family FunctionXylonolactonase (EC 3.1.1.68)


back to search