Query Sequence
>Ga0059261_1048
MTVRARVIPCLDVANGRVVKGVNFVNLRDAGDPVEQARAYDAAGADELCFLDITASHEARGTIIDVVRRTAEVCFMPLTVGGGVRSAEDARALLLAGADKVAVNSAAVTRPEVVSEIAERFGSQCIVASVDARRVADGRWEVFTHGGRKPTGIDAVEHALHLAKLGAGELLLTSMDRDGTRDGYDLDLIRTIADRVRVPVVASGGVGNLDHLVAGIRDGHASAVLAASIFHFGEASIVGAHAALAAAGIPVRSVG
Hit FamilyFIG00000258
Hit Family FunctionImidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)


back to search