Query Sequence
>Ga0059261_0549
MTRMRKAGCLMAAWIAVAGASAQEKPGFRDTPMLPDGKWRVHDADRPAPVVVTPATLPGGAPSDAIVLSPDAWQGQLAPWTVAGGVMTVPPRPAGGGDNNLVSRQSFGDVQLHLEFRSPNPPKDTSQDRGNSGVWFMQRYEVQILDGYRNPTYADGTVGAAYGWKPPLVNAARKPGEWQSYDIVFERPRFAADGKLLRPAYVTAFLNGVLVQNRQALLGTTVWRKVAAYQAHPDAAPLQLQDHGSPVSFRNIWVRPLPEAAVDHDLPGEAK
Hit FamilyFIG01112007
Hit Family Functionputative multi-domain protein


back to search