Query Sequence
>Ga0059261_0076
MQPPIDHRPGAQIQGRAVFPHAHLTGISGLQPHEILFLLDEAEQWIEANRSRAKSDHRLDGLTQINAFFENSTRTLLSFEIAGKRLGADVVNMHAAQSSVKKGETLIDTAMTLNAMRADVIVIRHMSSGAVQLIADKVDCPVLNAGDGSHEHPTQALLDALTIRRRRGSIAHQRVVICGDILHSRVARSNILALTALAAEVRVVAPSTLMPAAIEKMGVTPYTDFDAALEGADVVMMLRLQNERMSGAYIPSTREYHLNYGLTEERLKRAKPDALVMHPGPMNRGVEIDSSVADMPGRSAITEQVEMGVAVRMACLDVLTRRARGVEGWA
Hit FamilyFIG00000122
Hit Family FunctionAspartate carbamoyltransferase (EC 2.1.3.2)


back to search