Query Sequence
>GFF971
MNLDAPRTPELEQLLIDAEADDDEVQHSPPPVSRPWLLLLGLVLVALNLRPALSSLSPLLSEVSSSLGLSAARAGLLTTLPVLCLGLFAPLAPILARRFGAERVVLGILLMLAGGIVLRSAFGEVGLFVGSLIAGASIGIIGVLLPGIVKRDFAKQAGTMTGVYTMALCLGAALAAGASVPLSDYFGHRWSIGLGFWMLPALLAALCWLPQIGHKHGAHRVAYRVKGLLRDPLAWQVTLYMGLQSSLAYIVFGWVPSILIDRGLSATDAGLALSGSIIVQLLSALTAPWLATRGKDQRLAIVVVMLLTLGGLMGCLYAPLDGLWGWAILLGLGQGGTFSLALTLIVLRSRDAHVAANLSGMAQGIGYTLASLGPLAVGLIHDWTGGWAATGWVFAVIGLGAIVAGLGAGRAKYVGVCSEKV
Hit FamilyFIG00101140
Hit Family FunctionCyanate transport protein CynX


back to search