Query Sequence
>GFF931
MAKITFIGLGNMGGPMAGNLVKAGHEVTVFDLSKDAVAALVSEGAKTAGTAHEAASGAECVITMLPAGQHVEAVYLGDDGLLAKLPAGTLVIDSSTIAPETARGVAEVARAKDIPFLDAPVSGGVGGAKAGTLTFICGGSEEAFNKAKPILDTMGKNIFHAGDHGSGQVAKICNNMLLAILMSGTSEALALGVKNGLDPAVLSEIMKQSSGGNWALNVYNPWPGVMEGVPASRNYEGGFLVNLMTKDLGLAFDNAVKNQASIPMGSLARNLFQLHAGQGNGSLDFSSIQRLYKPE
Hit FamilyFIG00021583
Hit Family Function3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)


back to search