Query Sequence
>GFF92
MSAAEQLLPAASVSTEPLFAVRDLTRLYGPDKGCQGVSFDLYPGEVLGIVGESGSGKSTLLSLLCGRCPPDRGSVQYRDAAGDWLDLYAASEAERRTLLRTEWGFVEQNPRDGLRMGVSAGANIGERLMAQGVRHYGQLRAAGLDWLQQVEIDPARIDDLPRTFSGGMQQRLQIARNLVSSPKLVFMDEPTGGLDVSVQARLLDLLRGLVRELDLAVVIVTHDLAVARLLADRLMVMRRSRVVEAGLTDQILDDPQHPYTQLLVSSVLQP
Hit FamilyFIG00003283
Hit Family FunctionPhosphonates transport ATP-binding protein PhnK


back to search