Query Sequence
>GFF826
MPLNMAKNVFITCAVTGSGSTQDRSPHVPRSPKAIAESAIAAAKAGAAIVHCHVRDPETGAPSRDLTLYREVTDRIRESDTDVVLNLTAGMGGDMVFGDTENPLPLNEAGTDMIGATARMAHVAECLPEICTLDCGTMNFAEADYVMTNTPGMLRAMGQMMTDLGVKPEIEAFDTGHLWFAKELVKEGVLNSPALVQLCMGVPWGAPNDLNTFMAMVNNVPSDWDWSAFSLGRDQMAYVAASVLAGGNVRVGLEDNLWLGKGQLAENWQLVERAGTIIENMGAKLMGPDEVRAQLGLVKRAPVAK
Hit FamilyFIG01023126
Hit Family FunctionFIG01023127: hypothetical protein


back to search