Query Sequence
>GFF559
MKTVPCSAVIDGFDPTGGGLTRDAIGLGRVAEKGLDVRHGTILSLEDINVSFDGFKALTDLSLYIGVGELRCIIGPNGAGKTTMMDVITGKTRPTSGSAWFGETLDLTRMSEVDIAQAGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRAKLSGEQKDRIDEVLETIRLGQSRHRPAGLLSHGQKQFLEIGMLLMQSPQLLLLDEPVAGMTDAETEFTAELFKSLARKHSLMVVEHDMGFVETIADHVTVLHQGQVLAEGSLQQVQADERVIEVYLGR
Hit FamilyFIG00027526
Hit Family FunctionUrea ABC transporter, ATPase protein UrtD


back to search