Query Sequence
>GFF550
MIRDATQNDLPAIRDIYNDAVLNTTAIWNEQPADLGNRQAWFSARHALGYPILVSVENGEVTGYASFGDWRPFEGFRYSVEHSVYVRSDQRGKGLGPLLMEALIERARACGKHVMVAAIESGNQASIRLHERQGFITTGQMPQVGIKFGRWLDLTFMQLALNPGAEPPKE
Hit FamilyFIG01272034
Hit Family FunctionGCN5-related N-acetyltransferase


back to search