Query Sequence
>GFF4553
MKYRTLITLALVFTAGPAFAAGDAEAGGKLFTKTCGGCHSIGEGARGGFGPQLNGIIGRPAGTTADYQYSDAMKNSGVVWTRDKLAAYIEAPKKVVSGTRMIFWGISDQEKIDNILAYLETFQPK
Hit FamilyFIG00078450
Hit Family FunctionCytochrome c2


back to search