Query Sequence
>GFF4233
MLKRIYVPCDTTALSMGADKVAKLIERHANARGLEIELVRNGSRGLFWLEPLVEVETDSGRIGFGPVEAHDVDALVDAGLFEGKSDHPLCLGMVEDISYLKLQQRLTFSRIGITDPLSIADYRSHGGFVGLEQAVSLSPQAIVDEVKASGLRGRGGAAFPTGIKWQTVHDEPWQQQKYIVCNADEGDSGTFADRLAMECDPYMLIEGMTIAGLAVGATQGFIYLRSEYPVAHRILNEAISRAEAEGYLGRDVRGSGRAFNLEVRLAAGAYICGEETSLLESLEGKRGLVRAKPPLPAIKGLFGQPTVVNNVLSFAAVPFILAKGGQTYAHYGMGKSRGTLPIQLAGNIRRGGLIELAFGVSLREILEDFGGGTFTGRPMKAVQVGGPLMAYMPQNQWDTPMDYEAFAQLGAGIGHGGVVVFDDTVDMGEQARFAMEFCTVESCGKCTPCRIGSVRGLEVIDRIRAGESPEANLVLLEELCETMVDGSLCAMGGMTPFPVQSVMKYFPDDLTA
Hit FamilyFIG00002464
Hit Family FunctionNAD-dependent formate dehydrogenase beta subunit


back to search