Query Sequence
>GFF4217
MSRVVTVAATQMACSWDRQANIANADKLVREAAAKGAQIILIQELFETPYFCQKPNAEYLQLATPVEENPAIQHFQKVAAELQVVLPISFFELAGRARFNSIAIIDADGKLLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWNTRYAKIGVAICWDQWFPETARSMALMGAELLFYPTAIGSEPHDPNITSRDHWQRVQQGHAGANLMPLIASNRIGREEQDGYDITFYGSSFIADQFGAKVEEMDETSEGVLVHQFDLDQLEHIRSAWGVFRDRRPNLYGSIRTLDGSQPSE
Hit FamilyFIG00001378
Hit Family FunctionN-carbamoylputrescine amidase (3.5.1.53)


back to search