Query Sequence
>GFF4202
MTYEDILYDENNGVATITINRPDRYNAFRGQTCMELLDAFNRAGWNKDIGVIVFTGAGEKAFCTGGDQGAHEGQYDGRGLIGLPVEELQRTIREVPKPVIARVNGFAIGGGHVLHVICDLSIASETAIFGQVGPKVGSVDPGFGTAYLARVVGEKRAREIWYLCRKYSAQQALEWGLVNAVVPPEQLDEEVQKWCEEILEKSPTAISIAKRSFNADSDNIAGIGALGMQALSLYYDTDESKEGVNAFLEKRKPEFRKYYK
Hit FamilyFIG01962920
Hit Family Function2-ketocyclohexanecarboxyl-CoA hydrolase


back to search