Query Sequence
>GFF42
MNLLENKVALITGAGGGIGEGVARYFVKQGAAVIIAELSEQLGEAVAADLRAQGGKALFCHTDVSNKSSIENAVATAVDHFGSIDVLVNNAFAPTPNVKLEEKTDEMLTQTLNTTVWAAWWAMKAAFPHMCERGGGSIVNFYSIDTEIGAWLHGDYNTAKSAILGLTRSAAAEWGRFNIRANAIAPTAMGATFHKLAAENPGFEERSAAMRPLGRCGEPEADIGPVVAFLASEMSRFVTGESIHVDGGLHLPGYNSRPAEVPVREY
Hit FamilyFIG01747187
Hit Family FunctionPutative short-chain dehydrogenase/reductase (EC 1.1.1.100)


back to search