Query Sequence
>GFF4096
MTFNPGKKLYISDVTLRDGSHAIRHQYSIKNVQDIARALDKAKVDSIEVAHGDGLQGSSFNYGFGAHTDLEWIEAVAEVIEHAKIATLLLPGIGTVHDLDNAYNAGARIVRVATHCTEADVSKQHIEHARKLGMDTVGFLMMSHMQTPKGLAEQAKLMEDYGATCLYVVDSGGAMNMNDIRDRFRALKDVLKPETQTGMHAHHNLALGVANSIVAVEEGCDRIDASLAGMGAGAGNAPLEVCIAAFDKMGWEHGTDVYALMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEVAAQKYGLKAVDILVELGKRRMVGGQEDMIVDVALDLLAAQKEQNA
Hit FamilyFIG00001725
Hit Family Function4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)


back to search