Query Sequence
>GFF4089
MSHTVTIEPIGEQIEVEDGQTILQAALRQGVWLPFACGHGTCATCKVQVLEGDVEIGDASPFALMDIERDEGKVLACCATVESDVTIEADIDVDPDFEGYPVEDYTATVTGIVELSPTIRGVHLKLDRPMTFQAGQYINIELPGVDGARAFSLANPPGKADEVELHVRLVEGGAATTYIHEQLKTGDALNLSGPYGQFFVRSSQPGDLIFIAGGSGLSSPQSMILDLLEQNDERKIVLFQGARNLAELYNRELFEALDRDHDNFTYVPALSQAEEDAEWQGFRGYVHDAAKAHFDGRFAGNKAYLCGPPPMIDAAITALMQGRLFERDIFMEKFLTAADGAEDTQRSALFKKI
Hit FamilyFIG00148831
Hit Family FunctionPhenol hydroxylase, FAD- and [2Fe-2S]-containing reductase component DmpP


back to search