Query Sequence
>GFF3994
MAIRKLLIANRGEIAVRIARACSELGIRSVAIHSEADEYSLHVKKADEAYQISKDPLSGYLNPHHIVNMAVETGCDALHPGYGFLSENAELAAICEQRGITFVGPSANAISSMGDKTQARQTALAAGVPVTPGSEGNLADVEDAVVQAADIGYPVMLKATSGGGGRGIRRCDNEKELRQNFERVISEATKAFGSAEVFLEKCIIEPRHIEVQILADTHGNVVHLYERDCSIQRRNQKLIELAPSPQLEESQREYIGDLAKRVAKQCGYVNAGTVEFLLDHDGSFYFMEMNTRVQVEHTITEEITGVDIIKAQIRIAAGEPLGLKQEDISYRGFAAQFRINAEDPKNGFLPSFGRISRYYSAGGPGVRTDANMYTGYEIPPYYDSMCAKLIVWAMDWDELIARSRRALGDMGIYGVQTTIPYYKQILEHPDFQAADFNTGFVERNPQLLEYSSKTRPESIATAIAAAIAAQAGL
Hit FamilyFIG00002573
Hit Family FunctionPyruvate carboxylase subunit A (EC 6.4.1.1)


back to search