Query Sequence
>GFF3871
MRRIYEPLAYTDRPIRARYWDRFLPDPAPCYAPLQDEVTAEFAVIGGGYTGLSAALTLAEAGADVVLLDAQRPGWGASGRNGGLVSVGSAKLADDAILRRYGQADAEQFFAAERAAVDLVETYVERLALEVDRHSRGYTFVAHRPDRLTELHDYGQEYTRRYGLSYEFIPKEEMAAHGLNSPEFHGAVNLPVGFALNPMKFVLGLTRAVEAAGVRMFSDTPVQAITPAAGGYLLQGPAGQVRARHLLIATNGYSSDDLPQALAGRYLPVQSNIMVTRPLSEAEIADQGWWSEQMVCDSRTLLHYLRLLPDRRLLLGLRGSVRVSEENIAVTKARARADFDRMFPAWRAVETAHFWSGLICMTRNLVPFAGAIPGMKNAWAALGYHGSGVCMAPYAGALIADQALGRHQRPHPDLMQRPLRRFELGRWRRLSLPLAFGWYHIKDRI
Hit FamilyFIG01964097
Hit Family FunctionOxidoreductase


back to search