Query Sequence
>GFF3855
MTLMTHSVEIRDLDLHFGELQVLHQLNLDIEQGEFLVLLGSSGCGKSTLLNCIAGLLDISDGQIFIQGQNVTWAEPSERGIGMVFQSYALYPQMTVEGNLSFGLKNARLPKAEIAKRVARAAEVLQIEPLLKRKPAALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRADLRVELKRLHQQLANTMIYVTHDQVEAMTLADRIAIMKGGRIMQLSSPDEIYNRPQNLYVAGFIGSPAMNLIEGVLIDGVFHAGSLALPMQRYDYRNGPHHGAAVIGIRPEHILTGEQITRADATAEVLVDLVEGLGSDTLVYATHGAQNLRLRMDGASRVSAGDRLRIGFDTGRASLFDPNTEARL
Hit FamilyFIG00437806
Hit Family FunctionNucleoside ABC transporter, permease protein 1


back to search