Query Sequence
>GFF3853
MTPAPPTGRSGRSPTARPRPPRVLRNLNAKIASVPMILTALVVFMGGTAWTVAHSFTKSRLLPKWKFVGFDQYERLWSSNRWLISVENLLIYGLCSLVLTMAIGFTLAALLDRKIRFEGAFRTIFLYPFALSFVVTGLAWQWILNPDFGIQNVVRSWGWESFAFDPLNNPETVIFGVLIAGLWQGSGFVMVIMLAGLRGIDEDIWKAARVDGIGVTKTYVRVIIPMMRPVFVTALVIIASGIIKLYDLVVAQTNGGPGISSEVPAKYVINYMFEAQNLGQGFAASTMMLLSVIIILVPWAYLEFGGKKRG
Hit FamilyFIG01288623
Hit Family FunctionABC transporter, permease protein


back to search