Query Sequence
>GFF3783
MLATLGVITILCLLAAVMSKRLSPLVALIALPIIAALLGGFGLQTSAFIITGIKNVAPVVGMFVFAILFFGIMTDAGMLDPIIDRILRTVGTRPTRIVVGTATLALLVHLDGSGAVTFLVTVPAMLPLYTRLGIDKRILACVCAMAAGVNFLPWTGPVLRSSAALHVPVADLFQPLIPVQIVGLIFVFVCAWWLGRREEKRLGLGAGSTVDAVPQRVLSDDDIKLRRPRLFWVNLILTVLVMVVMIAGWVDPVVMFMLGTVVALCINYPNVDAQRARIDAHAKTALTMASILLAAGVFTGIMQGTGMLKAIAEVAVAQIPAGHGKLIPAVVGFISMPLSMLFDPDSYYFGVMPVIAEVGKALGVDPLQVAQASLLGVHTTGFPVSPLTPATFLLVGLCKIELADHQRFTIPFLFAASVLMTLTALLLGVI
Hit FamilyFIG00012536
Hit Family FunctionUncharacterized transporter, similarity to citrate transporter


back to search