Query Sequence
>GFF3782
MARILTITLNPALDLSVETAPLALGEVNRTGHTLMEPAGKGINVARVLARLGHSVTVAGLLGDANAAPFERLFEAEGLQDSFVRVPGQNRNNIKIAEAGGRVTDLNGPGFRAPEDALQRLQLRLKSLLPECDAVVIGGSLPDGFPPSGLAILVEQASRADKPVWLDTSGAGLKAGIKAGPYAIKPNTDELSDWAGTPLKDLASVAATVDGIRAGGVSHVVVSMGADGVFWSSPAGILRSRVPPVSLVSTVCAGDTLLAGMLHGVLGEQSEDTVLAFATALSAECVQHIGVGDPGAPDFHSLLQQTRVQPWPWQNNTGEIRL
Hit FamilyFIG00001366
Hit Family Function1-phosphofructokinase (EC 2.7.1.56)


back to search