Query Sequence
>GFF3753
MREVVIVDSVRTGLAKSFRGKFNQTRPDDMAAHCVNALLTRNGIDPATVEDCIVGAGSNEGAQGYNIGRNVAVLSQLGTGTAGMTLNRFCSSGLQAIAIAANQIASGCSDIIVAGGVESISLTLKSVNTDNLINPLLKEQVPGLYFPMGQTAEIVARRYSVSREEQDMYALQSQQRTAQAQADGLFDDEIVPMAVKYKVEDKNTGEAQVLDGVVDRDDCNRPDTTLASLQGLKPVFAEDGSVTAGNSSQLSDGASMTLVMSLEKALALGLKPKAFFRGFTVAGCEPDEMGIGPVFSVPKLLKAKGLQVADIDLWELNEAFASQCLYARNRLEIDNAKYNVNGGSISIGHPFGMTGSRQVGHLVRELQRRNLRYGIVTMCVGGGMGATGLFEAVR
Hit FamilyFIG00123196
Hit Family Function3-ketoacyl-CoA thiolase (EC 2.3.1.16)


back to search