Query Sequence
>GFF3652
MSLFSAVEMAPRDPILGLNEAFNADTRTTKVNLGVGVYCNEEGKIPLLRAVAEAEAIRVAQHAARGYLPIDGIAAYDKAVQTLLFGAESPLLNADRVTTVQAVGGTGALKLGADFLKQLLPDAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRAGLLEDLNALPSQSIVVLHACCHNPTGVDLSPADWQNVLDVIKAKNLVPFLDMAYQGFGDGIHEDAAAVRLFAESGLTFFVSSSFSKSFSLYGERVGALSIVGDSKEESARILSQVKRVIRTNYSNPPTHGAAIVAAVLNNPELRAQWEAELAEMRLRIRGMREQMVAELAKAAPGHDFSFVGRQRGMFSYSGLTVEQVTRLRSEFGIYALDTGRICVAALNQSNIDAVTKAIVQVL
Hit FamilyNo hits found for this sequence


back to search