Query Sequence
>GFF3588
MLSPYMSPVERAWYYALRILCALVLLFLIVPVLVIVPLSFNSGSFLVYPLQGFSMRWYEALFSSADWMRSLKNSMLIAPAATFLAVVLGTLAAVGLTRAEFRGKALLMTILISPMVVPVVIIGVASYLFFAPLGMGNSYLSLILVHAVLGVPFVIITVSATLQGFNYNLVRAAASLGASPLTAFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQITLPRQMFSGIRENLSPTIAAAATLLIGFSIALLLTLEWLRGRAEKLRTQQPA
Hit FamilyFIG00003894
Hit Family FunctionSpermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)


back to search