Query Sequence
>GFF3407
MTEQAPIIIVGTGLSGYSLAREIRKQDKETPVLIVTADDGVSYSKPMLSTGFTKGKDADGLAQGGTDAMADQLNVRIRTFVTVTGIDTEAHELILGDERLAYSKLVLAWGADVIRLGLDGDGQEHVFSINDLMDYRAFRDALGDGKRVAIMGAGLIGCEFANDLRNGGYEVDVIAPSEEVMPGLLPEAAAHAVQQELENLGVGFHLGTVVDRIDRRGDGVSLTLANGETLDADLVLSAVGLRPRTDLARAAGLETARGIVVNRALETSAPDVYALGDCAEVDGHVLLYVLPLMACSRALAKTLLGERTEVSYGTMPVMIKTPCCPTAVCPPPSEAEGNWEIEQDGTSVKALFKSAGGDVLGFAVTGSYAMEKQALSKEVPPIHG
Hit FamilyFIG01955903
Hit Family FunctionRubredoxin-NAD(+) reductase (EC 1.18.1.1)


back to search