Query Sequence
>GFF3358
MAGYDDRDGLIWMDGEMVNWRDAKVHILSHAMHYASSVFEGERAYNGKIFKSREHSERLIASAEALDMPMPYTVDQIEAAKEETLKASGLQDAYVRAVVWRGSGEDMGVASAKNPVRMAIAVWGWGAYYGDAKMQGAKLDIAEWKRPSPETIPVHAKAAGLYMICTISKHKAEAKGCSDALFMDYRGYVAEATGANIFFVKDGEVHTPKPDCFLNGITRQTVIGMLKDRGITVHERHIMPEELDGFEQCWLTGTAAEVTPVGQIGPHSFEVGELTQDIAKAYEELVRS
Hit FamilyFIG00050603
Hit Family FunctionBranched-chain amino acid aminotransferase (EC 2.6.1.42)


back to search