Query Sequence
>GFF3236
MLTIALSKGRILDDTLPLLAAAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVEHGAADLGVAGKDVLMEYGGQGLYEPLDLRIANCKLMTAGKVGAPEPKGRLRVATKFVNVAKRYYAEQGRQVDIIKLYGSMELAPLVGLADKIIDVVDTGNTLRANGLEPQELIAHISSRLVVNKASMKMQHARIQALIDILHAAVQQHQH
Hit FamilyFIG00000811
Hit Family FunctionATP phosphoribosyltransferase (EC 2.4.2.17)


back to search