Query Sequence
>GFF3112
MRTSVKKLVTAVSTSVALMGAGHAAAEIQIGIAGPMTGPVAQYGDMQFSGARMAIEQINANGGVMGEELVAVEYDDVCDPKQAVTVANSLVNDGVRFVIGHLCSSSTQPASDIYEDEGILMVTPASTSPEITERGYELVFRTIGLDSMQGPVAARYIASQNPERVAIVHDKQQYGEGIATAVRDTLKDAGVEIAMFEGITAGDKDFSSLVTKLKQADVDYVYYGGYHPELGLILRQANSADLDARFMGPEGVGNKDINTIAGEAAEGLLVTLPPAFDQKAENQALVKAFEDKGEDPSGPFVLTSYTAVQLVAEGIEAAGSTDPFDVAAALREGTFQTPIGTVEYDKAGDMKSFEFVVYEWHSDGSKTPVN
Hit FamilyFIG01304712
Hit Family FunctionHigh-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)


back to search