Query Sequence
>GFF3062
MRLLHTMLRVGDMDKSIAFYTEVLGMTLLRRKDYPDGKFTLAFVGYGDEAHNSVIELTHNWGVETYELGNGYGHIALEVEDVYKACEDIRARGGKITREPGPMMHGSSILAFVEDPDGYKIELLSPKRAD
Hit FamilyFIG00004743
Hit Family FunctionLactoylglutathione lyase (EC 4.4.1.5)


back to search