Query Sequence
>GFF3033
MTRDWWKHLILILGVIVVIAPFYMMVSYSFKSPGEIDRGEGGFFGRQEMMVDERCVKLRDPNRKDVAAAAHRFPGASDGEIRDALVAEAKADCAMRPVVFNYSKAFTEAPLLRYLLNGIIVTGSIFLIQVVVALPAAYALAKLKFWGREAVFGLVLFCLLIPVHAIALPLYIMLAKLGLTNTYAALVVPWTISVFGIFLMRQFFMTVPDDLIDAARMDGMGEFSIVWRVMLPTAIPALLAFAIFSIVAHWNDYFWPRIVVTGNRDLFTPPLGLREFKGDGDGSYFGPMMATATVIVTPLIVAFLLAQKRFIEGITLSGMK
Hit FamilyFIG00578477
Hit Family Functionsugar ABC transporter, permease protein


back to search