Query Sequence
>GFF295
MSSTQSSNDLEQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAAAGPAVLLAYAAAGTLVVLVMRMLAEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVLVIPLEANAAATILHAWFPDIAIWVFTLVITLLLTATNLFSVKNYGEFEFWFALIKVVAIVGFVILGLAAIFGFLPTSQVSGVSHLFDTQGFMPNGMGAVLAAILTTMFSFMGTEIVTIAAAESKNPGQQITKATNSVIWRIGLFYLLSIFIVVSLVPWNDPTLAAVGSYQTVLERMGIPNAKLIVDLVVLVAVTSCLNSALYTASRMLFSLGRRGDAPAVAKRTNKSGTPYWAVLLSTGAAFLAVFANYVAPAAVFEFLLASSGAIALLVYLVIAVSQLRMRQKRTAAGEKIVFKMWLFPGLTYAVMVFIVGTLTIMLFQEAHRIEIIATGVLSLLVVAAGLFVSSRRKTQRAGAAVLN
Hit FamilyFIG00955203
Hit Family Functiontransport permease protein of gamma-aminobutyrate


back to search