Query Sequence
>GFF2859
MLRHAFCTTLCGFAIAASFQVFAEAQRYPSEAGEVTVREIAAGFENPWALAFLPDGEHMLVTERPGRLRLVGLDGSRSKPLEGVPEVFAQAQGGLLDVRLSPDFESDRLVYLTYAEAGEQGKAGTAVGRGRLSDDHSKLENFEVIFRQLPKLSTGIHFGSRLVFDNDGHLFVALGENNQRPTSQDLDKHQGKVVRIGLDGSVPDDNPFIGQEGVRPEIWSYGHRNQQGAALNPWSGVLWTNEHGPRGGDEVNIPQAGKNYGWPLATHGINYSMLPIPEAKGKAVEGTEQPHHVWGKSPGVSGMAFYDGERFAAWQHSLFIGALVDQSLIRLRLDGDRIVGEERLLKDLGARIRDVRVGPDGYVYLLTDAGDGKLLQVGLQAE
Hit FamilyFIG01424109
Hit Family FunctionPQQ-dependent oxidoreductase, gdhB family


back to search