Query Sequence
>GFF2840
MQDLKGKVALVTGASRGIGRHIALQLAQRGADVAINYRSRQSEGEEVAKEIEATGVRALSFKADLSKMPEARSLVRQVQEQWGRIDILVNNAGITKDKSMKKLTDDDWNDVLDTNLGSVYATCSEVLKIMMDQKYGRIINITSFVGQAGNFGQANYAASKGGIIAFTKTLALEMAKYNITVNAIAPGFTETEMLAQVPENIREQIIARVPMGRFGKPEEIARAVVFLAAEGDYITGQQINVNGGVYM
Hit FamilyFIG01304054
Hit Family FunctionAcetoacetyl-CoA reductase (EC 1.1.1.36)


back to search