Query Sequence
>GFF2763
MKKLLLGTAIGFAAMTGSAFAAEGVTACLITKTDTNPFFVKMKEGAEAKAAELGMTLKSFAGKVDGDHETQVAAIETCIADGAKGILLTASDTSSIVPAVQQARDAGLVVIALDTPLEPIDSADATFATDNFLAGELIGKWAAASLGDEAANAKIAMLDLAVSQPTVGVLRDQGFLQGFGIDLGDPNKWGDETDPRIVGNDITAGNEEGGRRAMENLLAKDPMINVVYTINEPAAAGAYEALKSIGRENDVLIVSVDGGCPGVQNIKDGVIGATSQQYPLLMASKGIEAISAWATTGEKPAPTPGKAFFDTGVALVTDQPAEGVDSIDTAEGTNLCWG
Hit FamilyFIG00126855
Hit Family FunctionFructose ABC transporter, substrate-binding component FrcB


back to search