Query Sequence
>GFF2714
MSYETILLEVQGRVGLITLNRPQALNALNAQLVSELNQALDGLEADPQIGCIVLTGSRKAFAAGADIKEMAELTYPQIYLDDLFSDSDRVANRRKPIIAAVNGFALGGGCELALMCDFILAGDGAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLTGRFIDAVEAERCGIVARIVPADELLEEALKVATLIAGKSVPISMMVKESVNRAFEVSLSEGVRFERRVFHAAFATQDQKEGMAAFVAKRAPDFKDR
Hit FamilyFIG00014562
Hit Family FunctionEnoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)


back to search