Query Sequence
>GFF2591
MKTPEHCTGLSDIRQAIDSLDQQIIDALGLRMQYVKAASAFKPDQASIAAPERVAAMLPQRRQWAQAVGLDGEFIEGLFNQIIHWYIAEQTAFWLQKKSKVV
Hit FamilyNo hits found for this sequence


back to search