Query Sequence
>GFF2427
MNEQTLRGADCATSEDDQTLFQDSVRRFLQQEVAPHYEQWEADHQLPRALWHRLGEAGLLGVDLPEQLGGCAAGVETCLMICEEISRQGFGGLASGYNIHANIVMPYIHHLGNPAQQACWLPRMAAGEVLGAIAMTEPGAGSDLAAMRASAQKVPGGWKLNGSKVFITNGLLADMVIVCAKTDPNARARGVSLFLVDTTLPGFSRGKAIRKIGQHASDTAELFFDDLIVPEDALLGDAGKGFAYLMQELPRERLGVAAQAIGAIDGALQLTLDYVQQRRAFGQRIADFQNTRFTLAEVRAHLEMGRAYFEKCLQRYARGEMSSTDAAALKLMLSEMQCRCVDQCLQLFGGYGYTLEYPISRFYVDARIQTIYAGTSEIMKEVIARDMLGPVA
Hit FamilyFIG00009149
Hit Family FunctionButyryl-CoA dehydrogenase (EC 1.3.99.2)


back to search